8 research outputs found
Creación de un índice de citas de revistas españolas de Humanidades para el estudio de la actividad investigadora de los científicos de estas disciplinas
Los estudios bibliométricos basados en el análisis de citaciones han demostrado tener un gran interés, puesto que permiten evaluar la actividadcientífica desde distintas perspectivas. Sin embargo, su utilización entraña el problema del acceso a fuentes que proporcionen los datos necesarios sobre la bibliografía referenciada por los autores en sus trabajos, pues rara vezlos incluyen las bases de datos. El Institute for Scientific Information (ISI) es la única institución que produce bases de datos con las referencias bibliográficas de los documentos que indizan (Science Citation Index, SocialSciences Citation Index y Arts & Humanities Citation Index). Sin embargo,estas bases de datos tienen una escasa cobertura de las publicaciones editadas por países no anglosajones, especialmente en las áreas de humanidades.Por ello, un equipo multidisciplinar de la Universidad Carlos III de Madrid emprendió un proyecto piloto dirigido a crear un índice de citas de revistas españolas de humanidades, concretamente en el área de Historia, con el fin de analizar distintos aspectos vinculados con la actividad científica en esta disciplina, como autores y fuentes más citadas, la tipología documental utilizada por este colectivo, la obsolescencia de la información, o su capacidad idiomática. Estos aspectos se analizaron a partir de la información obtenida de las casi 25.000 referencias bibliográficas de revistas de españolas de Historia seleccionadas, durante los años 1997 y 1998.Bibliometric studies based on the analysis of citations have proved
interesting in the evaluation of scientific activity from different perspectives.
Their use, however, depends on access to data on the bibliography referenced
by authors in their papers, information that is rarely included in
databases. In fact, the Institute for Scientific Information (ISI) is the only
institution whose databases contain the bibliographic references cited in the
papers indexed (Science Citation Index, Social Sciences Citation Index and
Arts & Humanities Citation Index) and their coverage of scientific literature
published outside Anglo-Saxon countries is limited, particularly in the
area of humanities. For this reason, a multidisciplinary group at Madrid’s Carlos III University
undertook a pilot project designed to create a citation index of Spanish
humanities journals, specifically in the area of History, to analyse a
number of aspects relating to scientific activity in this discipline, such as
the authors and sources most often cited, typology of the documentation
used, obsolescence of the information or their knowledge of languages. These
issues were analysed based on nearly 25.000 bibliographic references cited
in papers published by selected Spanish history journals in 1997 and
1998
Genetic characterization and molecular identification of the bloodmeal sources of the potential bluetongue vector <it>Culicoides obsoletus</it> in the Canary Islands, Spain
Abstract Background Culicoides (Diptera: Ceratopogonidae) biting midges are vectors for a diversity of pathogens including bluetongue virus (BTV) that generate important economic losses. BTV has expanded its range in recent decades, probably due to the expansion of its main vector and the presence of other autochthonous competent vectors. Although the Canary Islands are still free of bluetongue disease (BTD), Spain and Europe have had to face up to a spread of bluetongue with disastrous consequences. Therefore, it is essential to identify the distribution of biting midges and understand their feeding patterns in areas susceptible to BTD. To that end, we captured biting midges on two farms in the Canary Islands (i) to identify the midge species in question and characterize their COI barcoding region and (ii) to ascertain the source of their bloodmeals using molecular tools. Methods Biting midges were captured using CDC traps baited with a 4-W blacklight (UV) bulb on Gran Canaria and on Tenerife. Biting midges were quantified and identified according to their wing patterns. A 688 bp segment of the mitochondrial COI gene of 20 biting midges (11 from Gran Canaria and 9 from Tenerife) were PCR amplified using the primers LCO1490 and HCO2198. Moreover, after selected all available females showing any rest of blood in their abdomen, a nested-PCR approach was used to amplify a fragment of the COI gene from vertebrate DNA contained in bloodmeals. The origin of bloodmeals was identified by comparison with the nucleotide-nucleotide basic alignment search tool (BLAST). Results The morphological identification of 491 female biting midges revealed the presence of a single morphospecies belonging to the Obsoletus group. When sequencing the barcoding region of the 20 females used to check genetic variability, we identified two haplotypes differing in a single base. Comparison analysis using the nucleotide-nucleotide basic alignment search tool (BLAST) showed that both haplotypes belong to Culicoides obsoletus, a potential BTV vector. As well, using molecular tools we identified the feeding sources of 136 biting midges and were able to confirm that C. obsoletus females feed on goats and sheep on both islands. Conclusions These results confirm that the feeding pattern of C. obsoletus is a potentially important factor in BTV transmission to susceptible hosts in case of introduction into the archipelago. Consequently, in the Canary Islands it is essential to maintain vigilance of Culicoides-transmitted viruses such as BTV and the novel Schmallenberg virus.</p
Genetic characterization and molecular identification of the bloodmeal sources of the potential bluetongue vector Culicoides obsoletus in the Canary Islands, Spain
Abstract Background: Culicoides (Diptera: Ceratopogonidae) biting midges are vectors for a diversity of pathogens including bluetongue virus (BTV) that generate important economic losses. BTV has expanded its range in recent decades, probably due to the expansion of its main vector and the presence of other autochthonous competent vectors. Although the Canary Islands are still free of bluetongue disease (BTD), Spain and Europe have had to face up to a spread of bluetongue with disastrous consequences. Therefore, it is essential to identify the distribution of biting midges and understand their feeding patterns in areas susceptible to BTD. To that end, we captured biting midges on two farms in the Canary Islands (i) to identify the midge species in question and characterize their COI barcoding region and (ii) to ascertain the source of their bloodmeals using molecular tools
Herpes simplex virus 1 spread in oligodendrocytic cells is highly dependent on MAl proteolipid
Myelin and lymphocyte protein (MAL) is a tetraspan integral membrane protein that resides in detergent-insoluble membrane fractions enriched in condensed membranes. MAL is expressed in oligodendrocytes, in Schwann cells, where it is essential for the stability of myelin, and at the apical membrane of epithelial cells, where it has a critical role in transport. In T lymphocytes, MAL is found at the immunological synapse and plays a crucial role in exosome secretion. However, no involvement of MAL in viral infections has been reported so far. Here, we show that herpes simplex virus 1 (HSV-1) virions travel in association with MAL-positive structures to reach the end of cellular processes, which contact uninfected oligodendrocytes. Importantly, the depletion of MAL led to a significant decrease in infection, with a drastic reduction in the number of lytic plaques in MAL-silenced cells. These results suggest a significant role for MAL in viral spread at cell contacts. The participation of MAL in the cell-to-cell spread of HSV-1 may shed light on the involvement of proteolipids in this process. IMPORTANCE Herpes simplex virus 1 (HSV-1) is a neurotropic pathogen that can infect many types of cells and establish latent infections in neurons. HSV-1 may spread from infected to uninfected cells by two main routes: by cell-free virus or by cell-to-cell spread. In the first case, virions exit into the extracellular space and then infect another cell from the outside. In the second case, viral transmission occurs through cell-to-cell contacts via a mechanism that is still poorly understood. A third mode of spread, using extracellular vesicles, also exists. In this study, we demonstrate the important role for a myelin protein, myelin and lymphocyte protein (MAL), in the process of cell-to-cell viral spread in oligodendrocytes. We show that MAL is involved in trafficking of virions along cell processes and that MAL depletion produces a significant alteration in the viral cycle, which reduces cell-to cell spread of HSV-1.Fundación Severo Ochoa-Aeromédica Canari
Herpes Simplex Virus 1 Spread in Oligodendrocytic Cells Is Highly Dependent on MAL Proteolipid.
Myelin and lymphocyte protein (MAL) is a tetraspan integral membrane protein that resides in detergent-insoluble membrane fractions enriched in condensed membranes. MAL is expressed in oligodendrocytes, in Schwann cells, where it is essential for the stability of myelin, and at the apical membrane of epithelial cells, where it has a critical role in transport. In T lymphocytes, MAL is found at the immunological synapse and plays a crucial role in exosome secretion. However, no involvement of MAL in viral infections has been reported so far. Here, we show that herpes simplex virus 1 (HSV-1) virions travel in association with MAL-positive structures to reach the end of cellular processes, which contact uninfected oligodendrocytes. Importantly, the depletion of MAL led to a significant decrease in infection, with a drastic reduction in the number of lytic plaques in MAL-silenced cells. These results suggest a significant role for MAL in viral spread at cell contacts. The participation of MAL in the cell-to-cell spread of HSV-1 may shed light on the involvement of proteolipids in this process
Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis
19 Pág.
Centro de Biotecnología y Genómica de Plantas (CBGP)The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development.This research was funded by projects APOGEO (Cooperation Program INTERREG-MAC 2014–2020, with European Funds for Regional Development-FEDER, “Agencia Canaria de Investigación, Innovación y Sociedad de la Información (ACIISI) del Gobierno de Canarias”, Project ProID2020010134 “Bioprospección y biotecnología en el descubrimiento de péptidos antimicrobianos contra patógenos resistentes” and Caja Canarias, Project 2019SP43. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results.Peer reviewe
Table_1_Quantitative ethnoveterinary study on plant resource utilization by indigenous communities in high-altitude regions.docx
For millennia, ethnic knowledge has been intricately tied to local biodiversity and woven into the fabric of rural communities. Growing scientific evidence suggests that merging ethnic knowledge with new scientific findings can lead to socially acceptable and environmentally friendly approaches essential for the long-term prosperity of local communities. In the high-altitude region, where livestock raising is a key income source, and plant-based utilization for ethno-veterinary practices is widely practiced. In this context, this study was conducted with the aim of documenting the ethno-veterinary use of plant resources in different bio-geographical regions of Jammu and Kashmir's Himalayas (J & KH). Semi-structured interviews and group discussions were used to collect information. Principal component analysis (PCA) and Pearson correlation were conducted to analyze the data. We documented 148 species from 53 families that locals used for various purposes: medicine, fodder, tonic, antidote, magic, and also used to protect themselves from ectoparasite such as Pediculus humanus capitis by the local inhabitants. There were significant differences in the relative usage of plant resources across the three biogeographic regions. Comparatively, the highest number (41%) of plant species were used for ethnoveterinary in the Jammu region, while the lowest number (28%) of species were used in Kashmir. Across the regions, Kashmir and Jammu had the highest level of species similarity (17%), while Jammu and Ladakh had the lowest (1%). A cross-regional assessment of plant resources revealed that 18% of plants were shared among the regions. The reported use of Amaranthus blitum, Morus alba, Ficus palmata, Vitex negundo, Juniperus semiglobosa, Ulmus wallichiana, and Rumex nepalensis are novel for the ethno-veterinary uses of this part of the Himalayan region. The various dry unique traditional fodder preparations (gaaslov, gass khor, pan baath, kaandbaath, Lovgooad, Karb, and Phungma) from plant resources are reported for the first time from the Himalayan region and can be ascribed to the novelty of this study. Plant resources were not only a source of fodder and medicine but also presented themselves as an opportunity for livelihood generation. Therefore, our findings bridge the knowledge gap by documenting key ethnoveterinary applications of native plant species from the study region that are used to cure livestock diseases and disorders by the mountain inhabitants.</p
Data_Sheet_1_Quantitative ethnoveterinary study on plant resource utilization by indigenous communities in high-altitude regions.docx
For millennia, ethnic knowledge has been intricately tied to local biodiversity and woven into the fabric of rural communities. Growing scientific evidence suggests that merging ethnic knowledge with new scientific findings can lead to socially acceptable and environmentally friendly approaches essential for the long-term prosperity of local communities. In the high-altitude region, where livestock raising is a key income source, and plant-based utilization for ethno-veterinary practices is widely practiced. In this context, this study was conducted with the aim of documenting the ethno-veterinary use of plant resources in different bio-geographical regions of Jammu and Kashmir's Himalayas (J & KH). Semi-structured interviews and group discussions were used to collect information. Principal component analysis (PCA) and Pearson correlation were conducted to analyze the data. We documented 148 species from 53 families that locals used for various purposes: medicine, fodder, tonic, antidote, magic, and also used to protect themselves from ectoparasite such as Pediculus humanus capitis by the local inhabitants. There were significant differences in the relative usage of plant resources across the three biogeographic regions. Comparatively, the highest number (41%) of plant species were used for ethnoveterinary in the Jammu region, while the lowest number (28%) of species were used in Kashmir. Across the regions, Kashmir and Jammu had the highest level of species similarity (17%), while Jammu and Ladakh had the lowest (1%). A cross-regional assessment of plant resources revealed that 18% of plants were shared among the regions. The reported use of Amaranthus blitum, Morus alba, Ficus palmata, Vitex negundo, Juniperus semiglobosa, Ulmus wallichiana, and Rumex nepalensis are novel for the ethno-veterinary uses of this part of the Himalayan region. The various dry unique traditional fodder preparations (gaaslov, gass khor, pan baath, kaandbaath, Lovgooad, Karb, and Phungma) from plant resources are reported for the first time from the Himalayan region and can be ascribed to the novelty of this study. Plant resources were not only a source of fodder and medicine but also presented themselves as an opportunity for livelihood generation. Therefore, our findings bridge the knowledge gap by documenting key ethnoveterinary applications of native plant species from the study region that are used to cure livestock diseases and disorders by the mountain inhabitants.</p